Znf346, Recombinant, Mouse, aa1-294, His-SUMO-Tag (Zinc Finger Protein 346)

Catalog No : USB-375917
471.28€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Znf346, Recombinant, Mouse, aa1-294, His-SUMO-Tag (Zinc Finger Protein 346)
Catalog No USB-375917
Supplier’s Catalog No 375917
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 48.7
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity. Source: Recombinant protein corresponding to aa1-294 from mouse Znf346, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~48.7kD AA Sequence: MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.