Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			TRIM28, Recombinant, Human, aa685-815, His-Tag (Tripartite Motif Containing 28, KRIP-1, KAP-1, TIF1-Beta, RNF96)
Catalog No			USB-298487
Supplier’s Catalog No			298487
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			15.6

Storage			-70°C
Other names
Grade			Purified
Purity			Purified (~87%)
Form			Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.
Reactivity life			12 months
Note			For reserch purpose only
Purity			Purified (~87%)
Description			The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa685-815 from human bromodomain TRIM28, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.6kD AA Sequence: MHHHHHHDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQ PGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRF FETRMNEAFGDTKFSAVLVEPPPM Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.