Transferrin (TRF) Recombinant, Porcine
Catalog No : USB-157105
388.52€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Transferrin (TRF) Recombinant, Porcine | ||
|---|---|---|---|
| Catalog No | USB-157105 | ||
| Supplier’s Catalog No | 157105 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant Porcine from E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 20.6 | ||
| Storage | 4°C/-70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥95% | ||
| Form | Supplied as lyophilized powder in PBS, pH7.4, 5% sucrose, 0.01% sarcosyl. Reconstitute in sterile PBS, pH7.2. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥95% | ||
| Description | Transferrin is a single polypeptide chain glycoprotein and is a member of the iron binding family of proteins. It has a molecular weight of 79.5kD and a serum concentration range of 1800-2700mg/L. It is synthesized in the liver and consists of two domains each having a high affinity reversible binding site for Fe3+. The iron is transported in blood and interstitial fluids to sites of use and disposal. Iron/transferrin is essential in hemoglobin synthesis and for certain types of cell division. Serum concentration rises in iron deficiency and pregnancy and falls in iron overload, infection and inflammatory conditions. Source: Recombinant Porcine from E. coli Purity: ≥95% Endotoxin: 1.0EU per 1ug (determined by the LAL method) Accession No: P09571 Fragment: Tyr318~Lys453 (Accession No: P09571) Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-YLG YQYVTALRNL REEISPDSSK NECKKVRWCA IGHEETQKCD AWSINSGGKI ECVSAENTED CIAKIVKGEA DAMSLDGGYI YIAGKCGLVP VLAENYKTEG ENCVNTPEKG YLAVAVVKKS SGPDLNWNNL KGK Epitope Tag: N-terminal Tags: His-tag and S-tag Molecular Weight: 20.6kD Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation, SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -80°C. Aliquots are stable for at least 12 months from date of shipment. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions. | ||
Product Details
© 2020 Imugex All Rights Reserved