EIF1, Recombinant, Human, aa1-113, GST-Tag (Eukaryotic Translation Initiation Factor 1)

Catalog No : USB-373150
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name EIF1, Recombinant, Human, aa1-113, GST-Tag (Eukaryotic Translation Initiation Factor 1)
Catalog No USB-373150
Supplier’s Catalog No 373150
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 39.7
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Source: Recombinant protein corresponding to aa1-113 from human EIF1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~39.7kD AA Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.