EIF2B1, Recombinant, Human, aa1-305, GST-Tag (Translation Initiation Factor eIF-2B Subunit alpha)

Catalog No : USB-373153
428.75€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name EIF2B1, Recombinant, Human, aa1-305, GST-Tag (Translation Initiation Factor eIF-2B Subunit alpha)
Catalog No USB-373153
Supplier’s Catalog No 373153
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 60.7
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Source: Recombinant protein corresponding to aa1-305 from human EIF2B1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~60.7kD AA Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.