MALD1, Recombinant, Malus domestica, aa2-159, His-Tag (Major allergen Mal d 1)
Catalog No : USB-374131
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | MALD1, Recombinant, Malus domestica, aa2-159, His-Tag (Major allergen Mal d 1) | ||
|---|---|---|---|
| Catalog No | USB-374131 | ||
| Supplier’s Catalog No | 374131 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 19.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Causes an allergic reaction in human; allergic reactions against this protein result from initial sensitization to the major allergen from birch pollen, Bet v 1. Source: Recombinant protein corresponding to aa2-159 from malus domestica MALD1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.5kD AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved