Non-specific Lipid-transfer Protein 1, Recombinant, Prunus Persica, aa1-91, His-SUMO-Tag
Catalog No : USB-374437
506.91€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Non-specific Lipid-transfer Protein 1, Recombinant, Prunus Persica, aa1-91, His-SUMO-Tag | ||
|---|---|---|---|
| Catalog No | USB-374437 | ||
| Supplier’s Catalog No | 374437 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 25.2 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. Source: Recombinant full length protein corresponding to aa1-91 from prunus persica Non-specific lipid-transfer protein 1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~25.2kD AA Sequence: ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved