TFF2, Recombinant, Human (Trefoil Factor 2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP)

Catalog No : USB-143514
354.03€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name TFF2, Recombinant, Human (Trefoil Factor 2, SML1, Spasmolysin, Spasmolytic Polypeptide, SP)
Catalog No USB-143514
Supplier’s Catalog No 143514
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight
Storage -20°C
Other names
Grade Highly Purified
Purity ≥98% by SDS-PAGE gel and HPLC analyses.
Form Supplied as a lyophilized powder.
Reactivity life 12 months
Note For reserch purpose only
Purity ≥98% by SDS-PAGE gel and HPLC analyses.
Description The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are expressed in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF2 has been shown to inhibit gastrointestinal motility and gastric acid secretion. Recent data suggests a potential role for TFF2 in acute and chronic asthma (Nikolaidis, N.M. et al. Am. Journal Respir. Cell Mol. Biol. (2003) 4: 458-464). Recombinant human TFF2 is a 12kD polypeptide of 107aa residues, which includes a 40aa trefoil motif containing three conserved intramolecular disulfide bonds. Biological Activity: Assay #1: Determined by its ability to chemoattract human monocytes using a concentration range of 1-10ug/ml. Assay #2: Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1-10ng/ml. AA Sequence: AEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein.