TFF3, Recombinant, Human (Trefoil Factor 3, Intestinal Trefoil Factor, hITF, Polypeptide P1.B, hP1.B, ITF, TFI)
Catalog No : USB-143515
354.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | TFF3, Recombinant, Human (Trefoil Factor 3, Intestinal Trefoil Factor, hITF, Polypeptide P1.B, hP1.B, ITF, TFI) | ||
|---|---|---|---|
| Catalog No | USB-143515 | ||
| Supplier’s Catalog No | 143515 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥98% by SDS-PAGE gel and HPLC analyses. | ||
| Form | Supplied as a lyophilized powder. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥98% by SDS-PAGE gel and HPLC analyses. | ||
| Description | The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are secreted in the gastrointestinal tract, and appear to play an important role in intestinal mucosal defense and repair. TFF-3 is expressed by goblet cells and in the uterus, and has also been shown to express in certain cancers, including colorectal, hepatocellular, and in biliary tumors. TFF3 may be useful as a molecular marker for certain types of cancer, but its role, if any, in tumorigenesis is unknown. TFF3 also promotes airway epithelial cell migration and differentiation. Recombinant human TFF3 is a 13.2kD homodimeric protein consisting of two 59aa chains, which includes a 40aa trefoil motif containing three conserved intramolecular disulfide bonds. Biological Activity: Determined by its ability to chemoattract human MCF-7 cells using a concentration range of 1-10ug/ml. AA Sequence: EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. | ||
Product Details
© 2020 Imugex All Rights Reserved