AGR2, Recombinant, Human, His-Tag (Anterior Gradient Protein 2 Homolog, Secreted Cement Gland Protein XAG-2 Homolog, AG-2, hAG-2, HPC8, AG2, Anterior Gradient 2, UNQ515/PRO1030)
Catalog No : USB-137529
583.92€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | AGR2, Recombinant, Human, His-Tag (Anterior Gradient Protein 2 Homolog, Secreted Cement Gland Protein XAG-2 Homolog, AG-2, hAG-2, HPC8, AG2, Anterior Gradient 2, UNQ515/PRO1030) | ||
|---|---|---|---|
| Catalog No | USB-137529 | ||
| Supplier’s Catalog No | 137529 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E.coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 22 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~95% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 20mM Tris, pH 8.0, 1mM DTT, 1mM EDTA, 10% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~95% (SDS-PAGE) | ||
| Description | AGR2 (Anterior gradient 2 homolog) is the human orthologue of the secreted Xenopus laevis Anterior Gradient protein (XAG-2). This is a small, possibly secreted molecule of yet weakly defined functions that is widely expressed in human tissues. Expression of AGR2 shows a positive correlation with expression of estrogen receptor in breast carcinoma and a negative correlation with expression of EGF receptor. Recombinant human AGR2, fused to His-tag at N-terminal domain, was expressed in E.coli and purified by using conventional chromatography techniques. Source: Recombinant protein corresponding to aa21-175 from human AGR2, fused to His-tag at N-terminal domain, expressed in E.coli. Molecular Weight: ~22kD (MALDI-TOF) Endotoxin: ~1EU/ug (LAL) AA Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMRDTTVKPGAKKDTKDSRPKLPQTLSRWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKT EL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved