AGR3, Recombinant, His-Tag (BCMP11, Anterior Gradient Protein 3 Homolog, Breast Cancer Membrane Protein 11)
Catalog No : USB-137530
583.92€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | AGR3, Recombinant, His-Tag (BCMP11, Anterior Gradient Protein 3 Homolog, Breast Cancer Membrane Protein 11) | ||
|---|---|---|---|
| Catalog No | USB-137530 | ||
| Supplier’s Catalog No | 137530 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E.coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 19.5 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in 20mM Tris-HCl, pH 8.0, 0.1M sodium chloride, 1mM DTT, 20% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | AGR3, also known as anterior gradient protein 3 homolog precursor, is a secreted cytoplasmic protein which is involved in metastasis induction and p53 tumour supressor inhibition. It may serve as molecular marker and potential therapeutic target for hormone-responsive breast tumours. Recombinant human AGR3 protein, fused to His-tag at N-terminal domain, was expressed in E.coli and purified by using conventional chromatography. Source: Recombinant protein corresponding to aa22-166 from human AGR3, fused to His-tag at N-terminal domain, expressed in E.coli. Molecular Weight: ~19.5kD (MALDI-TOF) Applications: Suitable for use in SDS-PAGE. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved