ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-Protein Kinase Transmembrane Receptor ROR1)

Catalog No : USB-375083
445.99€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-Protein Kinase Transmembrane Receptor ROR1)
Catalog No USB-375083
Supplier’s Catalog No 375083
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 42.5
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Tyrosine-protein kinase receptor whose role is not yet clear. Source: Recombinant protein corresponding to aa30-391 from human ROR1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.5kD AA Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.