Ubc10, Recombinant, Human (Ubiquitin Conjugating Enzyme 10)
Catalog No : USB-U0880-15
377.02€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Ubc10, Recombinant, Human (Ubiquitin Conjugating Enzyme 10) | ||
|---|---|---|---|
| Catalog No | USB-U0880-15 | ||
| Supplier’s Catalog No | U0880-15 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 21.1 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥ 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel. | ||
| Form | Supplied as a lyophilized powder in 1X PBS, 1mM DTT, pH 7.5. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥ 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel. | ||
| Description | UbcH10 is an essential mediator of mitotic destruction events and cell cycle progression. It catalyzes the destruction of cyclins A and B in conjunction with the anaphase-promoting complex, and therefore, plays an important role in the control of the cell exit from mitosis This activity is essential at then end of mitosis for the inactivation of their partner kinase Cdc2 and exit from mitosis into G1 of the next cell cycle. In addition, UbcH10 bears homology to yeast PAS2, a gene that is essential for biogenesis of peroxisomes. UbcH10 is useful for in vitro ubiquitinylation reactions. Recombinant Human Ubiquitin Conjugating Enzyme 10 produced in E.coli is a 21.1kD protein containing 191 amino acids. Recombinant Ubc10 protein contains 6xHis tag and is purified by proprietary chromatographic techniques. Sequence: MHHHHHHAMGIRMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFK WVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLL GEPNIDSPLNTHAAELWKNPTAFKKYLQESKQVTSQEP. Endotoxin: ≤ 0.1ng/ug (IEU/ug) of Recombinant Human Ubiquitin Conjugating Enzyme 10. Solubility: It is recommended to reconstitute the lyophilized Human Ubc10 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Stability: Lyophilized Recombinant Human Ubc10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution rhUbc10 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles. | ||
Product Details
© 2020 Imugex All Rights Reserved