Ubc12, Recombinant, Human (Ubiquitin Conjugating Enzyme 12)
Catalog No : USB-U0880-30
377.02€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Ubc12, Recombinant, Human (Ubiquitin Conjugating Enzyme 12) | ||
|---|---|---|---|
| Catalog No | USB-U0880-30 | ||
| Supplier’s Catalog No | U0880-30 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 25 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥ 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel. | ||
| Form | Supplied as a lyophilized powder in 1X PBS, 1mM DTT, pH 7.5. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥ 95% as determined by RP-HPLC, anion-exchange FPLC and/or reducing and non-reducing SDS-PAGE Silver Stained gel. | ||
| Description | Recombinant Human UbcH12 is functional in in vitro NEDDylation reactions. It has been shown to form a thioester linkage with NEDD8 in the presence of the NEDD8 activating enzyme complex Uba3/APP-BP1. APP-BP1 binds to the amyloid precursor protein (APP) carboxy terminal domain and is important in conjunction with Uba3 and UbcH12 in driving cells through the S to M checkpoint. It was demonstrated to be the E2 responsible for the NEDDylation of the Cul-1 component of the SCF( -TRCP) complex which is important as the E3-ligase in the ubiquitinylation of I B . NEDDylation of Cul-1 is essential for conjugation and processing of NF- B p105 by SCF( -TRCP) following phosphorylation of the complex. A dominant negative form of UbcH12, previously demonstrated to sequester NEDD8 and inhibit its conjugation, inhibits both conjugation and processing of p105, which is alleviated by wild-type UbcH12. Recombinant Human Ubiquitin Conjugating Enzyme 12 produced in E.coli is a 25kD protein containing 216 amino acids. Amino Acid Sequence: MSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINE LNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNIL REDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK. Endotoxin: ≤ 0.1ng/ug (IEU/ug) of rHuUbc12. Solubility: It is recommended to reconstitute the lyophilized rHuUbc12 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions. Stability: Lyophilized rHuUbc12 although stable at room temperature for 3 weeks, should be stored desiccated below -180C. Upon reconstitution rhUbc12 should be stored at 40C between 2-7 days and for future use below -180C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles. | ||
Product Details
© 2020 Imugex All Rights Reserved