Ubc10, Recombinant, Human, His-Tag (Ubiquitin Conjugating Enzyme 10, UbcH10)
Catalog No : USB-209285
473.58€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Ubc10, Recombinant, Human, His-Tag (Ubiquitin Conjugating Enzyme 10, UbcH10) | ||
|---|---|---|---|
| Catalog No | USB-209285 | ||
| Supplier’s Catalog No | 209285 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 21.1 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~95% (RP-HPLC, SDS-PAGE) | ||
| Form | Supplied as a lyophilized powder in PBS, pH 7.5, 1mM DTT. Reconstitute with 100ug/ml sterile ddH2O. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~95% (RP-HPLC, SDS-PAGE) | ||
| Description | UbcH10 is an essential mediator of mitotic destruction events and cell cycle progression. It catalyzes the destruction of cyclins A and B in conjunction with the anaphase-promoting complex, and therefore, plays an important role in the control of the cell exit from mitosis This activity is essential at then end of mitosis for the inactivation of their partner kinase Cdc2 and exit from mitosis into G1 of the next cell cycle. In addition, UbcH10 bears homology to yeast PAS2, a gene that is essential for biogenesis of peroxisomes. UbcH10 is useful for in vitro ubiquitinylation reactions. Source: Recombinant protein corresponding to 191aa from human Ubc10, fused to 6xHis-tag, expressed in E. coli. Molecular Weight: ~21.1kD AA Sequence: MHHHHHHAMGIRMASQNRDPAATSVAAARKGAEPSGGAARGP VGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTV YEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDIL KEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKK YLQESKQVTSQEP. Storage and Stability: Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved