SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)

Catalog No : USB-375342
527.60€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name SMT3, Recombinant, S. cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)
Catalog No USB-375342
Supplier’s Catalog No 375342
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 13.1
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Not known; suppressor of MIF2 mutations. Source: Recombinant protein corresponding to aa2-98 from saccharomyces cerevisiae SMT3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~13.1kD AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.