WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag (Bromodomain and WD Repeat Domain Containing 1, BRWD1, WD Repeat-Containing Protein 9)
Catalog No : USB-298491
587.37€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | WDR9 (BD2), Recombinant, Human, aa1308-1436, GST-tag (Bromodomain and WD Repeat Domain Containing 1, BRWD1, WD Repeat-Containing Protein 9) | ||
|---|---|---|---|
| Catalog No | USB-298491 | ||
| Supplier’s Catalog No | 298491 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 42 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | Highly Purified (~90%) | ||
| Form | Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM KCl, 0.04% Tween 20, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | Highly Purified (~90%) | ||
| Description | Source: Recombinant protein corresponding to bromodomain 2, aa1308-1436, from human WDR9, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42kD AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSIRATN YVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAG NYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNE KLRRSQ Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
Product Details
© 2020 Imugex All Rights Reserved