Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			DCAF7, Recombinant, Human, aa1-342, His-SUMO-Tag (DDB1-and CUL4-associated Factor 7)
Catalog No			USB-372993
Supplier’s Catalog No			372993
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			54.9

Storage			-20°C
Other names
Grade			Highly Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris, 50% glycerol.
Reactivity life			6 months
Note			For reserch purpose only
Purity			~90% (SDS-PAGE)
Description			Involved in craniofacial development. Acts upstream of the EDN1 pathway and is required for formation of the upper jaw equivalent, the palatoquadrate. The activity required for EDN1 pathway function differs between the first and second arches. Associates with DIAPH1 and controls GLI1 transcriptional activity. Could be involved in normal and disease skin development. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. Source: Recombinant protein corresponding to aa1-342 from human DCAF7, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.9kD AA Sequence: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.