WNT-1, Recombinant, Human (Proto-oncogene Wnt-1, Proto-oncogene Int-1 Homolog, INT1)
Catalog No : USB-143545
354.03€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | WNT-1, Recombinant, Human (Proto-oncogene Wnt-1, Proto-oncogene Int-1 Homolog, INT1) | ||
|---|---|---|---|
| Catalog No | USB-143545 | ||
| Supplier’s Catalog No | 143545 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥98% by SDS-PAGE gel and HPLC analyses. | ||
| Form | Supplied as a lyophilized powder. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ≥98% by SDS-PAGE gel and HPLC analyses. | ||
| Description | Wnt-1 is a secreted protein that signals through the Frizzled family of cell surface receptors and is required for normal embryonic development. Wnt-1 activation induces a complex signaling cascade that ultimately leads to the increased expression of over fifty genes. An important component of Wnt-1 signaling is the stabilization, and resulting accumulation, of the intracellular signaling protein, beta-catenin. Wnt signaling induces and maintains the transformed phenotype and, in certain embryonic cell lines, supports self renewal in the absence of significant differentiation. Elevated levels of Wnt proteins are associated with tumorigenesis and are present in numerous human breast cancers. Mature human Wnt-1 is a glycosylated protein containing 343aa residues. Recombinant human Wnt-1 is a 38.4kD, non-glycosylated protein containing 343aa residues. Biological Activity: The ED50 was determined by its ability to enhance BMP-2 induced alkaline phosphatase production by murine ATDC5 cells. The expected ED50 for this effect is 1.5-2.5ng/ml in the presence of 200ng/ml of human BMP-2. AA Sequence: ANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL Crossreactivity: Mouse Quality Control: Verified by N-terminal and Mass Spectrometry analyses (when applicable). Endotoxin: <0.1ng/ug of protein (<1EU/ug). Protein Content: Verified by UV Spectroscopy and/or SDS-PAGE gel. Storage and Stability: Store lyophilized products at -20°C. For reconstituted solutions of most products, we recommend short-term storage at 4°C. For longer term storage the protein solution should be stored with a carrier protein (eg. 0.1% BSA) in working aliquots and stored frozen at -20°C. Additional freeze/thaw cycles may cause some denaturation of the protein. | ||
Product Details
© 2020 Imugex All Rights Reserved