Frizzled-1, Recombinant, Human (FZD1)
Catalog No : USB-172329
603.47€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Frizzled-1, Recombinant, Human (FZD1) | ||
|---|---|---|---|
| Catalog No | USB-172329 | ||
| Supplier’s Catalog No | 172329 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 46.4 | ||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% | ||
| Form | Supplied as a liquid in 40mM Tris, pH 8.0, 110mM NaCl, 2.2mM KCl, 20% glycerol. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% | ||
| Description | Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Source: Recombinant protein corresponding to aa73-253 from human Frizzled-1, expressed in HEK293 cell expression system. Molecular Weight: ~46.4kD AA Sequence: QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAY NQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPC RSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLP EFWTSNPQHIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK Applications: Suitable for use in the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
© 2020 Imugex All Rights Reserved