Ang4, Recombinant, Mouse, aa25-144, His-SUMO-Tag (Angiogenin-4)

Catalog No : USB-372252
778.18€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Ang4, Recombinant, Mouse, aa25-144, His-SUMO-Tag (Angiogenin-4)
Catalog No USB-372252
Supplier’s Catalog No 372252
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 29.9
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E. coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts. Source: Recombinant protein corresponding to aa25-144 from mouse Ang4, fused to His-SUMO-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.9kD AA Sequence: QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.