ANOS1, Recombinant, Chicken, aa22-281, His-Tag (Anosmin-1)

Catalog No : USB-372263
865.54€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name ANOS1, Recombinant, Chicken, aa22-281, His-Tag (Anosmin-1)
Catalog No USB-372263
Supplier’s Catalog No 372263
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 33.2
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description May be an adhesion-like molecule with anti-protease activity. Source: Recombinant protein corresponding to aa22-281 from chicken ANOS1, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~33.2kD AA Sequence: SPAGPGAATARRQDEAFSTARCTSRCLSLQITRISAFFKHFQNNGSLAWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEADSECSGVKKCCSNGCGHTCQVPKNLYKGVPLKPRKELKFIELQSGDLEVKWSSKFNISIEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.