BTN2A2, Recombinant, Human, aa33-262, His-SUMO-Tag (Butyrophilin Subfamily 2 Member A2)

Catalog No : USB-372491
678.18€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name BTN2A2, Recombinant, Human, aa33-262, His-SUMO-Tag (Butyrophilin Subfamily 2 Member A2)
Catalog No USB-372491
Supplier’s Catalog No 372491
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 41.7
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion. Source: Recombinant protein corresponding to aa33-262 from human BTN2A2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.7kD AA Sequence: QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.