CS6 Fimbrial Subunit B, Recombinant, E. coli, aa22-167, His-Tag (CssB)

Catalog No : USB-372875
920.72€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name CS6 Fimbrial Subunit B, Recombinant, E. coli, aa22-167, His-Tag (CssB)
Catalog No USB-372875
Supplier’s Catalog No 372875
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 17.9
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Source: Recombinant protein corresponding to aa22-167 from E. coli CS6 Fimbrial Subunit B, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17.9kD AA Sequence: GNWQYKSLDVNVNIEQNFIPDIDSAVRIIPVNYDSDPKLNSQLYTVEMTIPAGVSAVKIVPTDSLTSSGQQIGKLVNVNNPDQNMNYYIRKDSGAGKFMAGQKGSFSVKENTSYTFSAIYTGGEYPNSGYSSGTYAGHLTVSFYSN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.