DBI, Recombinant, Human, aa2-105, His-Tag (Diazepam Binding Inhibitor, Acyl-CoA-binding Protein)
Catalog No : USB-372990
620.71€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | DBI, Recombinant, Human, aa2-105, His-Tag (Diazepam Binding Inhibitor, Acyl-CoA-binding Protein) | ||
|---|---|---|---|
| Catalog No | USB-372990 | ||
| Supplier’s Catalog No | 372990 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 13.9 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. Source: Recombinant protein corresponding to aa2-105 from human DBI, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.9kD AA Sequence: SQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved