DEFB130, Recombinant, Human, aa23-79, His-Tag (Beta-defensin 130)

Catalog No : USB-373029
846.00€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name DEFB130, Recombinant, Human, aa23-79, His-Tag (Beta-defensin 130)
Catalog No USB-373029
Supplier’s Catalog No 373029
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 8.3
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Has antibacterial activity. Source: Recombinant protein corresponding to aa23-79 from human DEFB130, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.3kD AA Sequence: GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.