DNA-binding Protein 7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-Tag (Sso7d)
Catalog No : USB-373076
920.72€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | DNA-binding Protein 7d, Recombinant, Sulfolobus Solfataricus, aa2-64, His-Tag (Sso7d) | ||
|---|---|---|---|
| Catalog No | USB-373076 | ||
| Supplier’s Catalog No | 373076 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, Yeast | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 9.1 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Constrain negative DNA supercoils; may be involved in maintaining the integrity of their genome at high temperature. Stimulates the Holliday junction cleavage activity of Hjc. Source: Recombinant protein corresponding to aa2-64 from sulfolobus solfataricus sso7d, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~9.1kD AA Sequence: ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved