Hirudin Variant-1, Recombinant, Hirudo Medicinalis, aa1-65, GST-Tag

Catalog No : USB-373626
865.54€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Hirudin Variant-1, Recombinant, Hirudo Medicinalis, aa1-65, GST-Tag
Catalog No USB-373626
Supplier’s Catalog No 373626
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 34
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen. Source: Full length recombinant protein corresponding to aa1-65 from hirudo medicinalis Hirudin Variant-1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34kD AA Sequence: VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.