Hrp1, Recombinant, Mycobacterium tuberculosis, aa1-143, His-SUMO-Tag (Hypoxic Response Protein 1)

Catalog No : USB-373683
809.22€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Hrp1, Recombinant, Mycobacterium tuberculosis, aa1-143, His-SUMO-Tag (Hypoxic Response Protein 1)
Catalog No USB-373683
Supplier’s Catalog No 373683
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 35.5
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Unlike some other CBS-domain containing proteins does not seem to bind AMP. Source: Recombinant protein corresponding to aa1-143 from mycobacterium tubervulosis Hrp1, fused to His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~35.5kD AA Sequence: MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.