LAP, Recombinant, Bovine, aa25-64, His-SUMO-Tag (Lingual Antimicrobial Peptide)

Catalog No : USB-373985
865.54€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name LAP, Recombinant, Bovine, aa25-64, His-SUMO-Tag (Lingual Antimicrobial Peptide)
Catalog No USB-373985
Supplier’s Catalog No 373985
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 20.5
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides. Source: Recombinant protein corresponding to aa25-64 from bovine LAP, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~20.5kD AA Sequence: VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.