LptD, Recombinant, Salmonella Typhi, aa73-169, His-SUMO-Tag (LPS-assembly Protein LptD)

Catalog No : USB-374077
865.54€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name LptD, Recombinant, Salmonella Typhi, aa73-169, His-SUMO-Tag (LPS-assembly Protein LptD)
Catalog No USB-374077
Supplier’s Catalog No 374077
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 26.9
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane. Source: Recombinant protein corresponding to aa73-169 from salmonella typhi IptD, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.9kD AA Sequence: VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.