Major Allergen Can f 1, Recombinant, Canine, aa19-174, His-SUMO-Tag

Catalog No : USB-374120
865.54€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Major Allergen Can f 1, Recombinant, Canine, aa19-174, His-SUMO-Tag
Catalog No USB-374120
Supplier’s Catalog No 374120
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 33.3
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Source: Recombinant protein corresponding to aa19-174 from canine Major allergen Can f1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.3kD AA Sequence: QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.