NAPG, Recombinant, Human, aa1-312, GST-Tag (Gamma-soluble NSF Attachment Protein)

Catalog No : USB-374371
678.18€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name NAPG, Recombinant, Human, aa1-312, GST-Tag (Gamma-soluble NSF Attachment Protein)
Catalog No USB-374371
Supplier’s Catalog No 374371
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 61.7
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. Source: Recombinant protein corresponding to aa1-312 from human NAPG, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~61.7kD AA Sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.