Pectate Lyase 1, Recombinant, Chamaecyparis Obtusa, aa22-375, His-Tag

Catalog No : USB-374661
920.72€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Pectate Lyase 1, Recombinant, Chamaecyparis Obtusa, aa22-375, His-Tag
Catalog No USB-374661
Supplier’s Catalog No 374661
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 40.1
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Has pectate lyase activity. Source: Recombinant protein corresponding to aa22-375 from chamaecyparis obtusa, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~40.1kD AA Sequence: DNPIDSCWRGDANWDQNRMKLADCAVGFGSSAMGGKGGAFYTVTSSDDDPVNPAPGTLRYGATRERSLWIIFSKNLNIKLNMPLYIAGNKTIDGRGAEVHIGNGGPCLFMRTVSHVILHGLNIHGCNTSVSGNVLISEASGVVPVHAQDGDAITMRNVTDVWIDHNSLSDSSDGLVDVTLASTGVTISNNHFFNHHKVMLLGHSDIYSDDKSMKVTVAFNQFGPNAGQRMPRARYGLIHVANNNYDPWSIYAIGGSSNPTILSEGNSFTAPNDSDKKEVTRRVGCESPSTCANWVWRSTQDSFNNGAYFVSSGKNEGTNIYNNNEAFKVENGSAAPQLTKNAGVLTCILSKPCS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.