RepD, Recombinant, Staphylococcus Aureus, aa1-311, His-SUMO-Tag (Replication Initiation Protein)

Catalog No : USB-375038
865.54€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name RepD, Recombinant, Staphylococcus Aureus, aa1-311, His-SUMO-Tag (Replication Initiation Protein)
Catalog No USB-375038
Supplier’s Catalog No 375038
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 53.5
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description This protein is probably a specific topoisomerase involved in initiating replication. This protein is specifically required and may be rate-limiting for replication of the plasmid in vivo. Source: Recombinant protein corresponding to aa1-311 from staphylococcus aureus Replication Initiation Protein, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.5kD AA Sequence: MSTENHSNYLQNKDLDNFSKTGYSNSRLSGNFFTTPQPELSFDAMTIVGNLNKTNAKKLSDFMSTEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWDRRNMRVEFNPNKLTHEEMLWLKQNIIDYMEDDGFTRLDLAFDFEDDLSDYYAMTDKAVKKTIFYGRNGKPETKYFGVRDSDRFIRIYNKKQERKDNADVEVMSEHLWRVEIELKRDMVDYWNDCFDDLHILKPDWTTPEKVKEQAMVYLLLNEEGTWGKLERHAKYKYKQLIKEISPIDLTELMKSTLKENEKQLQKQIDFWQREFRFWK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.