RS1, Recombinant, Human, aa24-224, His-Tag (Retinoschisin)

Catalog No : USB-375165
620.71€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name RS1, Recombinant, Human, aa24-224, His-Tag (Retinoschisin)
Catalog No USB-375165
Supplier’s Catalog No 375165
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 27
Storage -20°C
Other names
Grade Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description May be active in cell adhesion processes during retinal development. Source: Recombinant protein corresponding to aa24-224 from human RS1, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~27kD AA Sequence: STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.