TcyA, Recombinant, Bacillus Subtilis, aa20-268, His-SUMO-Tag (L-cystine-binding protein tcyA)

Catalog No : USB-375513
865.54€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name TcyA, Recombinant, Bacillus Subtilis, aa20-268, His-SUMO-Tag (L-cystine-binding protein tcyA)
Catalog No USB-375513
Supplier’s Catalog No 375513
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 43.6
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Part of the ABC transporter complex TcyABC involved in L-cystine import. Source: Recombinant protein corresponding to aa20-268 from bacillus subtilis tcyA, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.6kD AA Sequence: CGAGNDNQSKDNAKDGDLWASIKKKGVLTVGTEGTYEPFTYHDKDTDKLTGYDVEVITEVAKRLGLKVDFKETQWDSMFAGLNSKRFDVVANQVGKTDREDKYDFSDKYTTSRAVVVTKKDNNDIKSEADVKGKTSAQSLTSNYNKLATNAGAKVEGVEGMAQALQMIQQGRVDMTYNDKLAVLNYLKTSGNKNVKIAFETGEPQSTYFTFRKGSGEVVDQVNKALKEMKEDGTLSKISKKWFGEDVSK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.