Toxin MIT1, Recombinant, Dendroaspis Polylepis Polylepis, aa1-81, His-SUMO-Tag

Catalog No : USB-375634
865.54€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Toxin MIT1, Recombinant, Dendroaspis Polylepis Polylepis, aa1-81, His-SUMO-Tag
Catalog No USB-375634
Supplier’s Catalog No 375634
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 24.6
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Potently contracts gastrointestinal (GI) smooth muscle. The receptor for this toxin is present both in the CNS and in the smooth muscle and may be a potassium channel. Source: Recombinant protein corresponding to aa1-81 from dendroaspis polylepis polylepis Toxin MIT1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.6kD AA Sequence: AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.