Uncharacterized Protein KIAA1377, Recombinant, Human, aa559-670, His-SUMO-Tag (KIAA1377)

Catalog No : USB-375780
718.41€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Uncharacterized Protein KIAA1377, Recombinant, Human, aa559-670, His-SUMO-Tag (KIAA1377)
Catalog No USB-375780
Supplier’s Catalog No 375780
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 28.9
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Participates in cytokinesis. Necessary for microtubules and mitotic spindle organization. Involved in primary cilium formation. Source: Recombinant protein corresponding to aa559-670 from human KIAA1377, fused to His-SUMO-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.9kD AA Sequence: HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.