ZG16B, Recombinant, Human, aa53-208, His-Tag (Zymogen Granule Protein 16 Homolog B)

Catalog No : USB-370827
1101.18€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name ZG16B, Recombinant, Human, aa53-208, His-Tag (Zymogen Granule Protein 16 Homolog B)
Catalog No USB-370827
Supplier’s Catalog No 370827
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity
Applications
Molecular weight 19.21
Storage -20°C
Other names
Grade Purified
Purity ~85% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~85% (SDS-PAGE)
Description Source: Recombinant protein corresponding to aa53-208 from human ZG16B, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~19.21kD AA Sequence: GKMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.