ACRV1, Recombinant, Human, aa22-265, His-SUMO-Tag (Acrosomal Protein SP-10)
Catalog No : USB-372130
881.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | ACRV1, Recombinant, Human, aa22-265, His-SUMO-Tag (Acrosomal Protein SP-10) | ||
|---|---|---|---|
| Catalog No | USB-372130 | ||
| Supplier’s Catalog No | 372130 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 41.8 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | ACRV1 (Acrosomal vesicle protein 1), also known as acrosomal protein SP-10 or SPACA2, is a 265aa protein. ACRV1 is encoded by a gene that maps to human chromosome 11q24.2, at the junction between 11q23 and 11q24. Containing four exons, ACRV1 may experience cryptic splicing and exon skipping. ACRV1 exists as 11 alternatively spliced isoforms and may be involved in sperm-zona binding or penetration. ACRV1 encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1 that originates in the acrosomal vesicle during spermatogenesis, and is affiliated with acrosomal membranes and mature sperm matrix. ACRV1 is a potential contraceptive vaccine immunogen. Source: Recombinant protein corresponding to aa22-265 from human ACRV1, fused to His-SUMO-tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.8kD AA Sequence: QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved