Alba, Recombinant, Pyrococcus furiosus, aa1-93, His-SUMO-Tag (DNA/RNA-binding Protein albA)
Catalog No : USB-372218
1189.69€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Alba, Recombinant, Pyrococcus furiosus, aa1-93, His-SUMO-Tag (DNA/RNA-binding Protein albA) | ||
|---|---|---|---|
| Catalog No | USB-372218 | ||
| Supplier’s Catalog No | 372218 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 26.4 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ~90% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~90% (SDS-PAGE) | ||
| Description | Binds double-stranded DNA tightly but without sequence specificity. It is distributed uniformly and abundantly on the chromosome, suggesting a role in chromatin architecture. However, it does not significantly compact DNA. Binds rRNA and mRNA in vivo. May play a role in maintaining the structural and functional stability of RNA, and, perhaps, ribosomes. Source: Recombinant protein corresponding to aa1-93 from pyrococcus furiosus albA, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~26.4kD AA Sequence: MAEEHVVYIGKKPVMNYVLAVITQFNEGAKEVSIKARGRAISRAVDVAEIVRNRFLKDTVDIKEIKIGTEELPTADGRTTNTSTIEIVLERKV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved