ASB6, Recombinant, Human, aa1-197, HIs-SUMO-Tag (Ankyrin Repeat and SOCS Box Protein 6)

Catalog No : USB-372350
881.63€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name ASB6, Recombinant, Human, aa1-197, HIs-SUMO-Tag (Ankyrin Repeat and SOCS Box Protein 6)
Catalog No USB-372350
Supplier’s Catalog No 372350
Supplier US Biologicals
Source antigen Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight 38.4
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Source: Recombinant protein corresponding to aa1-197 from human ASB6, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.4kD AA Sequence: MPFLHGFRRIIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRDREKLLCSMLWPAATGCRSTILRTFVSYWKEGQTSRPPPKMGTQCSPASSSCLVRPWEGTKRRPR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.