BTN3A2, Recombinant, Human, aa30-248, His-SUMO-Tag (Butyrophilin Subfamily 3 Member A2)
Catalog No : USB-372494
881.63€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | BTN3A2, Recombinant, Human, aa30-248, His-SUMO-Tag (Butyrophilin Subfamily 3 Member A2) | ||
|---|---|---|---|
| Catalog No | USB-372494 | ||
| Supplier’s Catalog No | 372494 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | 39.59 | ||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Purified | ||
| Purity | ~85% (SDS-PAGE) | ||
| Form | Supplied as a liquid in Tris, 50% glycerol. | ||
| Reactivity life | 6 months | ||
| Note | For reserch purpose only | ||
| Purity | ~85% (SDS-PAGE) | ||
| Description | Plays a role in T-cell responses in the adaptive immune response. Inhibits the release of IFNG from activated T-cells. Source: Recombinant protein corresponding to aa30-248 from human BTN3A2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.59kD AA Sequence: QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
Product Details
© 2020 Imugex All Rights Reserved