Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Peptides & Proteins / Proteins

Product name			C14orf166, Recombinant, Human, aa1-244, GST-Tag (UPF0568 Protein C14orf166)
Catalog No			USB-372506
Supplier’s Catalog No			372506
Supplier			US Biologicals
Source antigen			Recombinant, E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			55.1

Storage			-20°C
Other names
Grade			Purified
Purity			~90% (SDS-PAGE)
Form			Supplied as a liquid in Tris, 50% glycerol.
Reactivity life			6 months
Note			For reserch purpose only
Purity			~90% (SDS-PAGE)
Description			RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. In case of infection by influenza virus A, is involved in viral replication. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport. Source: Recombinant protein corresponding to aa1-244 from human C14orf166, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~55.1kD AA Sequence: MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.