Streptavidin, Recombinant, Streptomyces Avidinii, aa25-183, His-Tag
Catalog No : USB-375445
527.60€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
Product name | Streptavidin, Recombinant, Streptomyces Avidinii, aa25-183, His-Tag | ||
---|---|---|---|
Catalog No | USB-375445 | ||
Supplier’s Catalog No | 375445 | ||
Supplier | US Biologicals | ||
Source antigen | Recombinant, Yeast | ||
Reactivity | |||
Cross reactivity | |||
Applications | |||
Molecular weight | 18.5 |
Storage | -20°C | ||
---|---|---|---|
Other names | |||
Grade | Purified | ||
Purity | ~90% (SDS-PAGE) | ||
Form | Supplied as a liquid in Tris, 50% glycerol. | ||
Reactivity life | 6 months | ||
Note | For reserch purpose only | ||
Description | The biological function of streptavidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of streptavidin). Source: Recombinant protein corresponding to aa25-183 from streptomyces avidinii Streptavidin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~18.5kD AA Sequence: DPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. |
© 2020 Imugex All Rights Reserved