Blue Fluorescent Protein, Recombinant (BFP)
Catalog No : USB-B2174-90
551.74€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Blue Fluorescent Protein, Recombinant (BFP) | ||
|---|---|---|---|
| Catalog No | USB-B2174-90 | ||
| Supplier’s Catalog No | B2174-90 | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -20°C | ||
|---|---|---|---|
| Other names | |||
| Grade | |||
| Purity | ≥97% by SDS-PAGE and HPLC | ||
| Form | Supplied as a lyophilized powder. Reconstitute with 100ul sterile ddH2O. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Description | Recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29kD monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. Applications: BFP is suitable as a control reagent for BFP expression studies or as a labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of BFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of BFP into cells and tissues, etc. The recombinant BFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP, YFP, or any other dyes. The 6XHis-Tag on the N-terminal can be used in Western blot detection with 6XHis-tag antibodies. The 6XHis-tag can also be used in removal or purification of the BFP. BFP Protein Sequence: MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK Endotoxin: ≤0.1ng/ug Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. | ||
© 2020 Imugex All Rights Reserved