Imugex

Shipping cost plus VAT not included , delivery in 7-14 business days

Categories: Biochemicals / Biochemicals

Product name			Green Fluorescent Protein, Enhanced (Aequorea Victoria) (GFP)
Catalog No			USB-G8965-14B
Supplier’s Catalog No			G8965-14B
Supplier			US Biologicals
Source antigen			E. coli
Reactivity
Cross reactivity
Applications
Molecular weight			30

Storage			-20°C
Other names
Grade			Highly Purified
Purity			≥90% by SDS-PAGE
Form			Supplied as a lyophilized powder. Reconstitute with 100ul sterile ddH2O.
Reactivity life			12 months
Note			For reserch purpose only
Description			Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. Sequence: Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK MVLLEFVTAAGITLGMDELYK Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer