Cyan Fluorescent Protein, Recombinant (CFP)
Catalog No : USB-C8385-01A
564.38€
0.00€
Shipping cost plus VAT not included , delivery in 7-14 business days
| Product name | Cyan Fluorescent Protein, Recombinant (CFP) | ||
|---|---|---|---|
| Catalog No | USB-C8385-01A | ||
| Supplier’s Catalog No | C8385-01A | ||
| Supplier | US Biologicals | ||
| Source antigen | Recombinant, E. coli | ||
| Reactivity | |||
| Cross reactivity | |||
| Applications | |||
| Molecular weight | |||
| Storage | -70°C | ||
|---|---|---|---|
| Other names | |||
| Grade | Highly Purified | ||
| Purity | ≥97% (SDS-PAGE and HPLC) | ||
| Form | Supplied as a lyophilized powder. Reconstitute with 100ul of ddH2O. | ||
| Reactivity life | 12 months | ||
| Note | For reserch purpose only | ||
| Description | The recombinant CFP (Cyan Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal CFP fluorescence. Endotoxin has been removed, and the protein is suitable for cell culture applications. The protein is a 29kD monomer with 264aa, and an N-terminal His tag, Ex./Em.=458/480nm, Extinction coefficient: 26000M-1CM-1. Applications: Suitable for use as a control reagent for CFP expression studies or as a labeling reagent. Also suitable for use as standards for SDS-PAGE, Western blot of CFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope or microinjection of CFP into cells and tissues, etc. The recombinant CFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP, RFP Cat #R1310-01B, or YFP, Cat #Y2043-01. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. AMINO ACID SEQUENCE: MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPV PWPTLVTTLAWGIQCFARYPEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRG EVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISDNVYIMPDKANNGLEANF KIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVL LESFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR Storage and Stability: May be stored at 4°C for short-term only. For long-term storage, aliquot to avoid repeated freezing and thawing and freeze at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. | ||
© 2020 Imugex All Rights Reserved