Coronavirus Spike Glycoprotein, Recombinant, Bovine, aa326-540, His-Tag (S)

Catalog No : USB-372847
1281.00€
0.00€

Shipping cost plus VAT not included , delivery in 7-14 business days

Product name Coronavirus Spike Glycoprotein, Recombinant, Bovine, aa326-540, His-Tag (S)
Catalog No USB-372847
Supplier’s Catalog No 372847
Supplier US Biologicals
Source antigen Recombinant, Yeast
Reactivity
Cross reactivity None
Applications User defined
Molecular weight 25,7 KDa
Storage -20°C
Other names
Grade Highly Purified
Purity ~90% (SDS-PAGE)
Form Supplied as a liquid in Tris, 50% glycerol.
Reactivity life 6 months
Note For reserch purpose only
Purity ~90% (SDS-PAGE)
Description S1 attaches the virion to the cell membrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection. S2 is a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Source: Recombinant protein corresponding to aa326-540 from bovine S, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.7kD AA Sequence: PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.